SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI80372 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI80372
Domain Number - Region: 180-208
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0046
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 
Domain Number - Region: 31-125
Classification Level Classification E-value
Superfamily Antivirulence factor 0.00562
Family Antivirulence factor 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI80372
Sequence length 419
Comment (Physcomitrella patens)
Sequence
MWVTVRAFTGQESVETVAQFLEAGFERIRVSSRFCTAFYTRAKCRGRLEQYGQYPHFQSY
TSNAQEWRSRPRGQSPLVESRRDNNGSYTPDLRPELYSMTTPAQAFEESIHHAAPGYVPH
YIPPYPYQMFGPGCYYNPDNSRNRTTRSHNYKDTVGVNEVNTNSASDPKSSGNRPFGPKL
SQYPNRRDEADMTFYQCGQRGHTRRNCQYQEAFQKLLEQELNRKAKPDVGVRSVTITEVE
EKGTEKKLQAKEPEQEHLDESSTPDEEQPVSAEWSELLRYCKQPSNRPTLKVKHDWGNQQ
VTICGNGTVRTIPVNPRTGPRPKLPEELNLLLTEEELIPIGTIELSARIQVDLMERHARP
YPQQFYEHKEGAVSIDEAPAYQKIPGGSVETWTKSEQKAVREINIGTDVDPKSLKINSN
Download sequence
Identical sequences A9SJS7
XP_001766559.1.60028 3218.JGI80372 jgi|Phypa1_1|80372|fgenesh1_pg.scaffold_85000111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]