SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI80392 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI80392
Domain Number - Region: 219-258
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0167
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI80392
Sequence length 793
Comment (Physcomitrella patens)
Sequence
MELNRISEKKTVELFGLATIPEIRDHITSIMDHYENSWEVFSHALKDKYFLEDADRVTKK
LFLGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQGKLELL
LEDKEEDEGLTTKWKNIEDAMGLFAKRERKKDRSDIPKTVQAPKVPVRTIPPTMPIIQPS
TSLSKKADMGMEEIIRGMRDLQIKLARLEENTSTNNLKNVSKQGYVQRCIWCDDASHTKK
DCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGIRALVQDYLKEHETAARESACY
GAVVDDDLSRIHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPV
KDTSASLGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEECILNAKVEFTLKEVLGIAK
KEFHDVIIDSIKRKRQLMGEIGMSHAIDARICRDEEEVDIGYKQPTNEKNGYNQRVHFED
SSDKEIETLSHYTRKHWAKVTTEVLVKVGDIEEPIVALVDHANNTRGELYGACPDVKIQI
GDVATEQHFFVQDTTSYPLILGQPYITATRMETKVLDDGSAYARVRSEDGRKAVQFLTVP
PNHERNRDRLREKPLPKIVEGFKDFGELGTLQDDERILGVYEENGLEDSLELITSIGLGD
NDKIAEVHSREVYTMLESFQAPEVTLETRYKTVDKKVNPVAKPLPEDSKEQMGEASKEAS
LRDPMSIGHQFTKETFKELKIGSDGSLLSEEITCFKKMLVKQGRIFAFKSHEIGCVDLNI
ITPMVIFTVPHVP
Download sequence
Identical sequences A9SJU7
jgi|Phypa1_1|80392|fgenesh1_pg.scaffold_86000019 XP_001766624.1.60028 3218.JGI80392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]