SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI80441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI80441
Domain Number - Region: 151-191
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0068
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI80441
Sequence length 337
Comment (Physcomitrella patens)
Sequence
MSSQATSSRRRPRDEEPPAPRRRWRIPSNRSLVIVFEVEPAYDGQPEGVLGGQFHNEDTE
VHAWSEVEGVGHYRWLQGPMNHLPRKQQLEFIADVMRQIFIFLDFKSIFCVRDTLSKKAD
MEIEEIIRGMQDLQIKLARLEENTSINNLKNVSKQGYVQRCIWCDDASHTRKDCNEFNNM
IRQGIICWKDGKIALKNREDLLQTNFGKGGMRALVQDYLKEHEIVVRESASYRARVDDEI
GGSTKTSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDLVESLSVHAYIAKSQHEA
LMEEKRRGNFDDTREGNLLRGKLEETRLGRQLHKNCL
Download sequence
Identical sequences A9SJZ7
XP_001766649.1.60028 3218.JGI80441 jgi|Phypa1_1|80441|fgenesh1_pg.scaffold_86000068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]