SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI80442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI80442
Domain Number - Region: 561-656
Classification Level Classification E-value
Superfamily Acid proteases 0.00225
Family Retroviral protease (retropepsin) 0.044
Further Details:      
 
Domain Number - Region: 330-369
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0262
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI80442
Sequence length 859
Comment (Physcomitrella patens)
Sequence
MGPELVGRLNVVPITGFDSVSGCPVLCAVSGNVVYGFLGEVSGGESSKGQGMHMDPSIAS
LFQAFSMSMQQQQSNDRKEALETKALQAVVNKIDQFDGRNISRYLRCYVREMELNRVSEK
KMVALFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADRITKKLFLGWIERP
NKNLQATELLSEFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEG
LTTKWKNVEDAMGLLTKKEKRKDRSNIPKTIQAPKAPVRTTPPTMPTVQPSTFLSKKADM
GMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMI
RQGIICWKDGKIALKNREDLLQTNFGKGGMRALVQDYLKEHEIVVRESASYRARVDDEIG
GTSLGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLGIVKKEF
HDVIIDSIKRKRQLMSETGMSHAIDARICRDEEEVDIGYKQPTNEKNGYNQRVRFEDSSD
KEMETLSHYTQKHWARATTEILVKVGDIEEPVVALVDHGSEINLMSKDLYKKQKWPIDME
HGWAIRAANNTWGELYGACPDVKIRIGDVATEQHFFVQDTTSYPLILGQPYITATRMETK
VLDDGSAYARVRSEDGRKAVQFLTVPPNHERNRDRLREKPLPKIVEGFKDFGEIHSREVY
TMLESFQALEVTVETRYKTADKKVKPVAGPLPEDSKEQMGEASKEASLRDPMSIGHQFTE
ETFEELKIGSDGSLLPEEITCFKKMLAKQGRSFAFESHEIGCVDPNIITPMVIFTVPHSF
EKIEAIAAEVSVVMVNRDF
Download sequence
Identical sequences A9SJZ8
XP_001766698.1.60028 3218.JGI80442 jgi|Phypa1_1|80442|fgenesh1_pg.scaffold_86000069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]