SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI80683 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI80683
Domain Number 1 Region: 228-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.8e-34
Family Ubiquitin-related 0.0000304
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.49e-33
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 3 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.94e-33
Family Ubiquitin-related 0.0000331
Further Details:      
 
Domain Number 4 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.94e-33
Family Ubiquitin-related 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI80683
Sequence length 344
Comment (Physcomitrella patens)
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYSIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYSIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGISDTVCNVRRIYISQATPEQQHLFVDGVRSRPYFGRFQHA
Download sequence
Identical sequences A9SKL6
jgi|Phypa1_1|80683|fgenesh1_pg.scaffold_88000082 3218.JGI80683 XP_001766873.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]