SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI80698 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI80698
Domain Number 1 Region: 143-189
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000136
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI80698
Sequence length 309
Comment (Physcomitrella patens)
Sequence
MFVKEAQPVTVSASLDRAKVWEECHYDQFLTACATMIPVQSNYQYPALNGSMGSYPQMIE
TVAHSSANTQGPVNITPLQALSPQVTTAYAPYFPYQTQESTLAEKKIIPASKDSNEALLL
NLTKKMEEMAINMAKDKEKRQKPTNTRTNVWCSNCQGHGHLITECPSPSQVLGKCTFCGG
KHLIVNCWNLQRQQQFSNPTMIPPTPWDVNQIQSLEKMEGINRGLQDSLVNRVKCVHTVL
TRSQQKGKGPIKHLEDPKAKGQSHPIMDPSHSDPDSRKVLSPDLVAKPNEVPITESSVPS
RTGLFLPQF
Download sequence
Identical sequences A9SKN2
jgi|Phypa1_1|80698|fgenesh1_pg.scaffold_88000097 XP_001766881.1.60028 3218.JGI80698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]