SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI80754 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI80754
Domain Number 1 Region: 212-249
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000994
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI80754
Sequence length 294
Comment (Physcomitrella patens)
Sequence
MCLDNGNSDNTLESYVPLEKLRRALVGNFVNIPVEILRSLTEREGGIEVFGTPLGNFPIG
GTAETSNRGSADWHELVANKGNYIVFQNPTFLPASQPIKLFVGNNSKARTAESSVIREDQ
PFRLQFKWVPWAIVRLASYHYLLFVVCQAVLPSSSQPYVPYSAYQKPIPTKELTNELVSR
DPNESLLLTLTKKMDELAVNLAKDKEKRHKPTNMRPNVWCSNCKGQGHLVTECSSPPQMM
VQCTFCGGPADANKPTGGGQRSCSMGLTSTSRRGGERSAYQRPTERQESNSGPG
Download sequence
Identical sequences A9SKZ9
3218.JGI80754 XP_001767022.1.60028 jgi|Phypa1_1|80754|fgenesh1_pg.scaffold_89000023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]