SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI80870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI80870
Domain Number - Region: 230-272
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000272
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI80870
Sequence length 506
Comment (Physcomitrella patens)
Sequence
MPVGLLATTVPENLPKFYGTKDDDPILHMERYIEILTTSLIGNEGYYLVWFPGTLHSEAY
NWYRDHDEGHFTTWSQLQVAFLNHFRPEVGQSTALRALGAGVLERNLVTLEEAKTAAHVV
DLIERSYERHWRKEDESIPGFIPINPVSQAVGPSTSSTPSIVNNGAQYYNVMSTATKAPL
PLLALLEPQLERRVEDLEKKIQAGQEGFQDSMMKQIQALTEQMAFMVKNQNSNTLPPRIE
SGNHNSGVWCTTCGQNGHSSLQCRVRPQGNPNLQPYQPTQGYRRYRRPQQRQGGYQGGPQ
GYGRSGRPRKEYHELCRRWHESGQCWDDGQPWACGNCGGNHPTHECRQPDKVIQLPPPIT
NPYENARNNMRDQRRPHSDDQRGLKPPNLYYNYEDFRQNHQPPKGLQTHQGYIPVAQNQQ
GGYRNYVNQKQGPSFNQDVRVAEEVLLKGPAPSLAKTTVVIEEHEAPSNLVIHELKKDGG
GSHENATLAVITRGQVQRQSPIDEED
Download sequence
Identical sequences A9SL48
jgi|Phypa1_1|80870|fgenesh1_pg.scaffold_90000012 XP_001767075.1.60028 3218.JGI80870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]