SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81139 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI81139
Domain Number - Region: 324-346
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0392
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 134-228
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0693
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0098
Further Details:      
 
Domain Number - Region: 77-141
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0981
Family Insect pheromone/odorant-binding proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81139
Sequence length 352
Comment (Physcomitrella patens)
Sequence
MWSRLRGSILFQAVLFSVPSQGTLFSVNGFLKGKNGGESLAARANFGSKLELGANFRSKL
EQQQSNDQKEALATKALQAVVNKIDQFDGRNISRYLRCYVCEMELNRVSEKKMVALFGLA
TIPEIRDHITSITDRCGNSWEDFSHALKDKYFLEDADRVTKKLFLGWIERPNKNLQATEL
LREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVE
DAVGLLTKKERRKDRSNIPKQVQAPKAPVRTTPSTMPTVQPSTSLSKNTDMGMEEIIRGM
RDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIR
Download sequence
Identical sequences A9SLU3
XP_001767318.1.60028 jgi|Phypa1_1|81139|fgenesh1_pg.scaffold_92000019 3218.JGI81139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]