SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI81159
Domain Number - Region: 302-335
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00732
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81159
Sequence length 437
Comment (Physcomitrella patens)
Sequence
MGKRTTKTAFQRLDKDVLESEVQMEQEVPKPKKRLVKKQPLLKEGPPCIQEMESEEEVQV
EQEEFEESLQVTQEPHSDEEENDKEGRNPKSQRPSSLKTSPDSMKGSRVEKQSVVSIDEV
EKMVMRLMEEKNKELEKKMEVNQLLIDSLMKENVRKEALLEGQKGKSSSHRAKTDQARKW
KGSALDWFDGKIKTNPNYAKETIWIEVCNGLIARLNMATRKKYWERETIPTNINDAFALA
CQLELKEEEVSHSEESTMTKTWEGKTNFQGRTRPFHGNKKPPFPKRRFEEDTSQVGKLKI
KESQRSSTKRAKTSSPNVTYFKCQQKEHYANECKNEEVPRNVSKLRNTYLLNETLEVDCL
QTMSLSKKVPVREGDFQRKLTLTSLHKKLIYLNIKVRNLETSMLIDTRATNCQGQRFNEG
KYTQKDYLDIISQNINK
Download sequence
Identical sequences A9SLW3
jgi|Phypa1_1|81159|fgenesh1_pg.scaffold_92000039 XP_001767368.1.60028 3218.JGI81159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]