SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI81179
Domain Number - Region: 176-222
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000977
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81179
Sequence length 352
Comment (Physcomitrella patens)
Sequence
MRNFVKIPVEILRPLTEREGGIEEFGTPLDIFSVEGTAETSNSGSSDWHKLVANKDNYIV
FQNPMFLPVIQSIKLIVENNSKSRSTESSEIRIRENRDYFKTEFSRTRNLMASGGVAISI
AVQMGTVGDCMTSVMPLSTFRGISSTDLNQYLSQFLTKMEEMAINMAKDKEKKQKLTNTR
TNVWCSNCKGHGHSVTKCPSSSQIMGQCTFCGGKYLTANCWNWQRQQQQFSNQTMIQATS
WDVNQVVNVVLTRGQQKDKNLIQDLNEPIAGEQVASSTGQNEPISVLGCIPILRLQQIEE
PNSVLHANLSRPSNPSPVMSFVPNMRPDSVAQPNEVPITEALVLFQAVLIST
Download sequence
Identical sequences A9SLY2
XP_001767378.1.60028 jgi|Phypa1_1|81179|fgenesh1_pg.scaffold_92000059 3218.JGI81179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]