SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81209 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI81209
Domain Number - Region: 184-224
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81209
Sequence length 786
Comment (Physcomitrella patens)
Sequence
MGEPGLKSQLDPISRHPIQVFLHALKDEYFLEDADHVTKKLFLEWIERPNKNLQVTELLR
EFERQYSQLSKVEKLTLEPNKIDLFLQAANGELQGKLELLLEDKEEDEGLTTKKEKDRSN
IPKTVQASKAPVHTTPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLAKLEENTSTN
NLKNISKQGYIQRCIWCDDASHSRKDCNEFNNMIRQGIICWKDGKIAFKDRDDLLQTNFG
KGGMRALVQDYLKEHETAARESTSYGARVDDDLYGSMETSEFWTFAVSTMQEGKLPREAL
LRTVVTIRGATVHAYIAKSQHEALMEEKRQGNFDDTGKENSSKKQTQGDKALEAASQELP
IKDTSASLGEKTKETKDKSKSIAYKLLSDIEATTNLKGVLKERILYAKVEFQLKEVLEIT
KKEFHDVIIDSIKQKRQLMGETGMSHAIDARICRDEEEVDIGYKQPTNEKNGYNQRVRFE
DSSDKEMETLSHYTRKHWARATTEVLVNVGDIEEPIVALVDHGSMSKDLYKKQKWPIDIE
HGWVIRATNNTRGELYEACPDVKIRIGDVATEQHFFVQDTTPYPLILGQPYIMATRMETK
VLEDGSTYARLRSEDGRKAVQFLTVPPNHERNRDRLREKPLPKFVEGFKDFGELATLKDD
ERILGIYEKNGLEDSLELITSIRLGDNDKIVEIHSREVYTILESFQAPKVTVETRYKTVD
KKVKPVVEPLPEDSKEQMGEALKEASLRDPMNIRHQFTKKTFEELKISSDGSLLSKGNYL
LQKDVG
Download sequence
Identical sequences A9SM10
XP_001767433.1.60028 jgi|Phypa1_1|81209|fgenesh1_pg.scaffold_93000011 3218.JGI81209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]