SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI81319
Domain Number - Region: 378-486
Classification Level Classification E-value
Superfamily YwmB-like 0.0126
Family YwmB-like 0.034
Further Details:      
 
Domain Number - Region: 222-261
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0131
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81319
Sequence length 497
Comment (Physcomitrella patens)
Sequence
MNTRTTPKRKLLEGSRGLSLEGSRNLSLEGSKDYVPNIAPSFSFEVSEKQCYCQSIPTQE
NEDLSHNVCYEFQLLFMSNNKAMIERKLWQPKHCKQWSIKLINLMGGIFQAADGELQEKL
EPLLQDKEEDKGLTTKWKNVEDAVGLLTKKERRKDRSNIPKIVQAPKAPVHTTPPTMPTV
QPSTSLSKKADMGIEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASH
TRKDCNEFNNMIRQGIICWKDGKIALKDREDLFQTNFGKGRMRALVQDYLKEHETIVRES
ASYGARVDDEIGGSTETTTIRERIGWEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTR
EGNSFKRQTRGDKAQEAASQELPVKDTSASLGEKTKETKDKGKSIAYKLLSDIEAATNLK
GVLEEHILNAKVEFTLKEVLGIAKKEFHDVIIDSIKRKRQLMSETGMSHAIDARICRDEE
EVDIGYKQPTNEKNGYN
Download sequence
Identical sequences A9SMA2
3218.JGI81319 jgi|Phypa1_1|81319|fgenesh1_pg.scaffold_94000016 XP_001767483.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]