SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81356 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI81356
Domain Number 1 Region: 307-343
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000101
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81356
Sequence length 462
Comment (Physcomitrella patens)
Sequence
MSGDYDYDNHRRNQQVKERQERFYFKNLLRQQQEGIQRKKRRWSWIKPWLHACASIRAYP
SSERSAILHHYIPLEKLPRALVGDTASNEASESSSVIIRSLSTEELNNSDSLQERRVSKY
QIGTKRRIHINIARRLAQAPMAEEAALVPIAVQMGAIGDRTTSMAPLPTFNGWPELKMFV
KESQPVTVAASLARAKVWKECHYDQLLMVGTTMIPSVGNQVPMTNTMIWSYPRMIAPSMG
NPNSQGVVNATPLQVIPPVATYPSPMAYRQPEVLMNATINDSNEALLLNLMKKMEELAVH
MTKDKEKRHKPSNMRPNVWCNNCKGQGHFDMECPSPHQKMEQYMFCGGNQLLESPVHRVE
AIHAVLTRNQQKGKEPIQILEKLISAPVNRPIPKSAPLLDEASPSQPNLTNILVRPPISQ
VPILHQYGGQSHQLKDPIFKEQLQPEIKEVPILDIGSTNIQG
Download sequence
Identical sequences A9SMD6
3218.JGI81356 jgi|Phypa1_1|81356|fgenesh1_pg.scaffold_94000053 XP_001767546.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]