SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81395 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI81395
Domain Number - Region: 277-316
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81395
Sequence length 844
Comment (Physcomitrella patens)
Sequence
MDPSIASLFQAFSLSMQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREME
LNRVSERKMVALFGLATIPEIRDHITTITDRCGNSWEDFSHALKDEYFLEDADHVTKKLF
LGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLE
DKEEDEGLTTKWKNVEDAVGLLTKKERRNDRSNIPKTVQAPKAPVRTTPPTMPAVQPSTS
LSKKADMGMEENIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDC
NEFNKMIRHGIICWKDGKIALKEREDLLQTSFGKGGMRALVQDYLKGHETVIRESASYGA
RVDDAIGGSRKTTSLGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLKERILNAEVEFTL
KEVLEIAKKEFHDVIIDSIKRKRKLMSETEMSHAIDARICRDEEEVDIGYKQPTNEKNGY
NQRVHFEDSSDIGMETLSHYTRKHWARATTEVLVKPIDMEHGWAIQAANNTQEKLYGAYR
DVKIQIGDVAMEQHIFVQDTMSYPLILGQPYITATRMETKVLDDGSAYARVRSEDGRKVV
QFLTVPRNHERNRDRLREKPLPKIVEGFKDFGEEVLSRDEGAFDASFIGILENGNIMYKK
VDDFKRKERKRLYDIEGQLRKIGTLQDDERILGVYEENGLEDSLELNTSIGIGDNDKIVE
IHSREVYTMLESFQVPEVTVETRYKTADKKVKPVAGPLPEDSKEQMGEASKEASLRDPMS
IGHQFTEETFEELKIGSDGSLLPEEITCFKKMLAKQEIPQQEDESDMDNEGDDDKLDKDV
GDIF
Download sequence
Identical sequences A9SMH2
jgi|Phypa1_1|81395|fgenesh1_pg.scaffold_94000092 XP_001767565.1.60028 3218.JGI81395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]