SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81627 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI81627
Domain Number - Region: 196-221
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0136
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81627
Sequence length 604
Comment (Physcomitrella patens)
Sequence
MDLLKSFIFQQSKTDRLLDYRRISILPSTARRPARSRAGKHNLQAKELLREFERQYSQLS
KVEKLTLEPNKVDLFLQAVDGELQEKLEPLLEDKEEDEGLTTKWKNVKDAVGLLTKKERR
KDRSNIPKTVQTPKAPVRTTPPTMPTVQPSTSLSKKADMEMEEIIRGMRDLQIKLARLEE
NTSINNSKNVSKHGYVQRCIWCDDASHFRKDCNEFNNMIRQGIICWKDGKIALKDREDLL
QTNFGKGGMRALVQDYLKEHETAARESASYGARVDDEIGGSTKTSKFWASTVSTIQEGKL
PREALLRIAATIRGRTGWEDPVESLSVHPYIAKSQHEALMEEKRRGNFDDTREGNSSKRQ
TRGDKTWEAASQELPVKSGIFGRCSTHYIEVLLCIEVQVSSCIGVVRAAIMVLFANGRSW
ICSGQVSGMFGTLRVKREYLGQFVLIEQEGRLGITDLHFDIPSTEYSSLARLSDILEMVA
NMKFDEEPNHKKLVLLFDCILGPNPTMRFINIDGVEKPFVSSIPYKLIRREGELDVEEDE
DDQPKKKSRLGMPVTQWITTFTTLGGQMKQRYHYDVADSKHTEYVESDNEDSLYISSVAS
CTNL
Download sequence
Identical sequences A9SN43
XP_001767779.1.60028 3218.JGI81627 jgi|Phypa1_1|81627|fgenesh1_pg.scaffold_96000132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]