SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI81653
Domain Number - Region: 46-88
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0162
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 193-286
Classification Level Classification E-value
Superfamily Acid proteases 0.025
Family Retroviral protease (retropepsin) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81653
Sequence length 459
Comment (Physcomitrella patens)
Sequence
MPTVQPSTFLSKKADMGMEEIIRGMRDLQIKLARLEENTSTNNSKNVSKQGYVQSCIWCD
DASHTRKDCNEFNNMIRQGIICSKDGKIALKNREDLLQTNFGKGGMRALVQDYLKEHETV
ARESASYGARVDDEIEGSTKTNEEEVDIGYKQPTNEKNGYNQRVRFKDSSDKEMETLSHY
TRKHWAKATTEVLVKVGDIEEPIVALVNHGSEINLMSKDLYKKQKWPIDMEHGWAIRAAN
NTLGELYGACLDVKIQIGDVATEQHFFVQDTTSYPLILGQPYITTTRMETKVLDDGSAYA
KRDYRSTKEEVLSQDEGTFDASFISILEDGNIMYKKVDDFKRKERKRLYNIERKLCKLGT
LQDDERILGVYEENGLEDSLELITSIGLGDNDKIVEIHSREVYTILESFQAAEVTVETRY
KTVDKKVKPVAGPLPEDSKEQIEEASKEASLRDPMSIGH
Download sequence
Identical sequences A9SN70
XP_001767854.1.60028 3218.JGI81653 jgi|Phypa1_1|81653|fgenesh1_pg.scaffold_97000022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]