SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI82274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI82274
Domain Number - Region: 210-247
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI82274
Sequence length 845
Comment (Physcomitrella patens)
Sequence
MELNRVSKKKMVTLFGLATIPETRDHITSIMDRCGNSWEVFSHALKDEYFLEDADRVTKK
LFPEWIERLNKNLQYCQLSKVEKLTLEPNKVDLFLQAADGELQGKLELLLEDKEEVEGLT
TKWKDVEDAVGLLTKRERMKDRSNIPKIVQAPKAPVHTTLPTMPTVQPSTSLSKKADMGM
EEIIRGMRDRQIKLIRLQENTSTNNSKSVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQ
GIICWKDGKIALNDREDLLQTNFGKGGMRALVQDYLKEHETAARESASNGARVDDEIGGS
TETSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDRVESLSVHAYIAKSQHEALME
EKRRGNFDDTREGNSFKRQTRGDKVREAASQELPVKDTSASLGEKTTETKDKGKLIAYKL
LSDIEAGTNLKGVLEERLLNAKVEFTLKEVLGIVKKEFHDVIIDSIKRKRIYRDEERLIL
VTSNQQMKRMGIINEYVSKIVVIRKWKPSAIILESIEQGQDNLISRQHGWKQKYLTMVLL
MQGYVDAVQFLTVPPNHERNRDRLREKPLPKIVEGFKDFGEEVLSRDEGAFDASFIGILE
NGNIMYKKVNDFKRKERKRLYNIEGELRKLGTLQDDERILGIYEENGLEDSLELITSIGL
RDNDKIVEIHSREVYTILESFQAPEVTVEMRYKTADKKIKLVAGPLPKDSKKQMGEASKE
ASLRDPMSIGHQFTKETFEELKIGSDGSLLLEEITCFKRMLAKQGRSFAFESHEIGYLEY
WEQRPTPVQILSGQAVMFSVPFQGTLFLVKGSLKDKNGGESSDGKSQFWIQALMAGANFG
SKMED
Download sequence
Identical sequences A9SPR5
3218.JGI82274 XP_001768351.1.60028 jgi|Phypa1_1|82274|fgenesh1_pg.scaffold_101000138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]