SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI82370 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI82370
Domain Number - Region: 296-341
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000258
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI82370
Sequence length 874
Comment (Physcomitrella patens)
Sequence
MCLDNGNSDDTLESYVPLEKLPRTLAENFVNIPVEILKPLTERKGGIEVFGTLLGNFSVG
GTTETSNRGSADSHELVANKDNYIVFQNLTFLPASQPIKLFAGNNSKARTVESSVIRVRE
SRDYFKTNFRGTENSMAAGGLAVPIAVQMGTLGDRTTSVAPLPTFRGLPASLERAKVWEE
CHYDQHLTVGATMIPSQGDYQMTNWNDALESYPGRSDNGTIPQGIVNAVPLQAVLPSSSQ
PYVPYSAYQKPIPTKELTNELVSRDLNESLLLTLTKKMDELAVNLAKDKEKRHKPTNMRP
NIWCSNCKGQGHLVTECSSPPQMMVQCTFCGGKHTTANCWNLRKQQQVGQQTMSQPTSWD
VNQMQTSQPAEDKGPVQRDSPVHRVEVVNAMLTRGQQKGKNPIQDLDDPIEVTIVAPSKR
RTEPISVLGRILILSPQQDEEPTSVSRANFSGTSRSIPNDHVPIPAQPNISSYPLKEPLV
VEESTKRKELLPNKAVLFSVPFQGTLFSVNGFLKGFLGEVSGGESSKGQGMHMDPSIASL
FQAFSLSMQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLSCYVREMELNRVSEKK
MVALFGLATIPEIRKNITSITDHCGNSWEDFSHALKDEYFLEDADRVTKKLFLGWIERPN
KNLQATELLREFERQYSQLSKGIICWKDGKIALKNREDLLQTNFGKGQMRALIQDYLKEH
ETVARESASYGARVDNDLGGSTETSEFWTSAISTMQEGKLPREALLKTTATVRGAIGWKD
PVESLSIHAYIAKSQHEALMEEKRRGNFDHTREGNSFKRQTRGDKAREAASQELPVKDTS
ASLGEKTTETKDKGKSIAYKLLSDIEAATNLKGV
Download sequence
Identical sequences A9SQ04
3218.JGI82370 jgi|Phypa1_1|82370|fgenesh1_pg.scaffold_102000093 XP_001768389.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]