SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI82468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI82468
Domain Number - Region: 329-369
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00384
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 
Domain Number - Region: 30-64,92-153
Classification Level Classification E-value
Superfamily PP2C-like 0.0127
Family PP2C-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI82468
Sequence length 431
Comment (Physcomitrella patens)
Sequence
MAVGVPEVPIVVQMGAVGDQTTSMAPLPTFNGWSGSDPDHHISQFLTTCMANNEIGLLLM
FNYLEYWEQRPTPVQILSGQVVLFSVPFQGTLFSVKRSLKETYQLGQKGLRQAIEGHPYR
FTVYSCSCLYFNSQKPINCLNIGESPYYLLQRDAQRVVEQKARMHMDPSIASLFQAISLS
MQQQQSNDRKEALATKALQAVVEKLTLEPNKVDLFLEAADGELQGKLKLLLKDKEEDEGL
TTKWKNVEDVVMLLTKRERRKDRSNFPKTVQAPKAPIRTTPPIMPTVQPSTSLSKKADME
MEEIIQGMRDLQIKLARLEENTSTNNSKNVSKQGYVQRCIWCDDASHIRKDCNEFNNMIR
QGIICWKDGKIAFKDREDLLQTNFGKREMRALVQDYLKEHETAARESASYGARVDDEIGG
STEISEFLSRP
Download sequence
Identical sequences A9SQ97
jgi|Phypa1_1|82468|fgenesh1_pg.scaffold_103000063 XP_001768550.1.60028 3218.JGI82468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]