SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI82555 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI82555
Domain Number - Region: 219-259
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0162
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 605-641
Classification Level Classification E-value
Superfamily HP0062-like 0.0759
Family HP0062-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI82555
Sequence length 747
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVALFGLATIPEIRDHITLITDRYRNSWEVFSHALKDEYFLEDADRVTKK
LFLEWIERPNKNLQATELLRKFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPL
LEDKEEDEGLTTKWKNVEDAVGLFTKKERKKDRSNIPKTVQAPKAPVRTTLPTMPTVQPL
TSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINISKNVSKQGYVQRCIWCDDASHTRK
DCNEFNNMIWQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETAARESISY
GARVDDEIGGSTETSEFWASAVSTMQEGKLPREALLRTAATIRGRTYREDPVESLSVHAY
IAKSQHEALMEEKRRGNFDDTREGNSSKRQTRGDKAREAASQELHVKDTSATLGEKKKKT
KDKGKSITYKLLSNIEAATNLKEVLEERILNAKVEFTLKEVLGIVKKEFHHVIIDSIKRK
RQLMGEIGMRHAIDARIYKDEEKVDIGYKQPTNEKNGYNQRVRFEDSSDKEMGTLSHYTR
KHWARATTEVLVKVGDVEEPIVALIDHGSEINLMVCSKDGRKVVQFLTVPPNHERNRDRL
REKPLPKIVEGFKDFGEKRKKRLYDIEEQLHKLGTFQDDERILGVYEENGLEDSLELITS
IGLGDDDKVVEIHSREVYTMLESFQAPEVTVETRYKTADKKVKPVAGPLPEDSKEQMREA
SKEASLRDPMSIGHQFTKETFEIENWF
Download sequence
Identical sequences A9SQI2
XP_001768659.1.60028 3218.JGI82555 jgi|Phypa1_1|82555|fgenesh1_pg.scaffold_104000054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]