SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI83202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI83202
Domain Number - Region: 349-373
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0994
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI83202
Sequence length 907
Comment (Physcomitrella patens)
Sequence
MWSRLRGSILFQAVLFSVPSQGMLFSVNGFLKGKLGGGASFQASARLPVRFSLEVFLKIK
EIRERSFMLQVGEGKTENLDFSSSWSLGKTEALAAESFIFKQSKSDRLLDYRRISILPST
ARRPARSRAGKHDFWEKFLVGSLLKDKVCTWIRLLLVCFKPSHCQCSNNKAMIERKLWQL
KHCKQWSIKLINLMGGIFQELQATELLREFERQYSQLSKVEKLTLELNKVDLFLQAADGE
LQEKLEPLLEDKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIPKTVQAPKAPVRTTPP
TMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWC
DDASHTRKDCNEFNNMIQQGIISWKYGKIALKNREDLLQTNFGKGGMRVLVQDYLKEHEI
VVRESASYGARVDDEIGGSTETSEFWASAVYTMQEGKLPREALLRTAATIRGRTGWEDPV
ESLSVHAYIAKSQHEALMEEKRRGNFDDTRERNSFKRQTRGDKAREAASQELPLLSDIEA
ATNLKGVLEERILNAKVEFTLKEVLEIVKKEFHDVIIDSIKRKRQLMSEIGMSHAIDARI
CRDEEEVDIGYKQPTNEKNGYNQRVRFEDSSDKEIETLSHYTRKHWARATIEVLVKEGDI
DEPIVALVNHGSEINLMSKDLYKKQKKPIDIEHGWAIRATNNTWGQLYGAYPDVKIRIGD
VATEQHFFVQDTTSYPLILGQPYITATRIETKVLDDGSAYARVRSEDRKKALQFLTVPPN
HERNRERMREKPLPKIVEGFKDFGELGALQDDERILGVYEENGLEDSLELISSIGLGDND
KIVEIHSREVYTMLESFQAPEVIVETRYKTTDKKIKPVVGPLPEDSKEQMGEASKEARNY
LLQKDVG
Download sequence
Identical sequences A9SS04
jgi|Phypa1_1|83202|fgenesh1_pg.scaffold_111000017 XP_001769131.1.60028 3218.JGI83202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]