SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI83590 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI83590
Domain Number 1 Region: 298-343
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000733
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI83590
Sequence length 381
Comment (Physcomitrella patens)
Sequence
MVNKNESIASRKINQLRERQGRAQGRNLRREEQECNLKRKHRQNWIKPWLQACRRIQTYQ
EPDRLLILQSYVLLEKLPRALARNFVNIPVEILRPLIEREGRIEVFGTPLGNFPVGGTAE
TSNRGSADWHELVANKGNYIVFQNMTFSPASQPIKLFGGNNSKARTAESSVIRVRESKDY
FKTNFRGTKNSMAAGGPAVPIAVQMGTLGDRTTSIAPLPTFRGLSGIVNAVPLQVVLPSS
SQPYVPYSAYQKPIPTKELTNELVSRDPNESLLLTLTKKMDELVVNLAKDKEKRHKPTNM
RPNVWCSNCKGQGHLVTECSSPSQMMVQCTFCGGKHTTANCWNLRKQQQVGQQTMSQPTS
WDVNQVQTNNRFGWNGNRANR
Download sequence
Identical sequences A9SSZ2
XP_001769515.1.60028 jgi|Phypa1_1|83590|fgenesh1_pg.scaffold_115000007 3218.JGI83590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]