SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI83701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI83701
Domain Number 1 Region: 79-114
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000497
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI83701
Sequence length 148
Comment (Physcomitrella patens)
Sequence
MLMEKDKHTHTHGQAKQEHDLPPPRWWFIRQNEPRTLTSDLEISEQALPTTARTLSRPES
TSGDPPQWWMDQEPNQPWQSNQRKPHPVEFNRHESGNICRHCGALNHWTRECPIYKIEEQ
LKRLTVRLQDLRSCASFDQAQSLCGLQN
Download sequence
Identical sequences A9STA1
jgi|Phypa1_1|83701|fgenesh1_pg.scaffold_116000036 3218.JGI83701 XP_001769618.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]