SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI83769 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI83769
Domain Number - Region: 161-196
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00419
Family Retrovirus zinc finger-like domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI83769
Sequence length 215
Comment (Physcomitrella patens)
Sequence
MATGGPAIPIAVQMGDVSDHTTSVAPLPTFRSFSDVDLNQYLSQFLIAFLNCGSYVDSSL
RQLSKSNLERINGCLSTDILDTRVNSNANIQEPINITPLQAILPNVTTAYAPYFPYQQQA
LTVAELPIIPTPKDSNEALLLNKTKKIEEMAVNMAKDKEKRQKPTNTRTNIWYSNCKGHG
HLVTECSSPSQMMDQCTFYGGKHLTTNCWNLQRQQ
Download sequence
Identical sequences A9STG5
XP_001769644.1.60028 jgi|Phypa1_1|83769|fgenesh1_pg.scaffold_117000013 3218.JGI83769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]