SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI83800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI83800
Domain Number - Region: 99-127
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00146
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI83800
Sequence length 128
Comment (Physcomitrella patens)
Sequence
MFLSSGSQQIQPKNVLMDNYPRMAASNVKNVMLQQPINATTFQAIVPIIMTAYFISPTYQ
QSELFTNATVKDPDEALLLNLRKKMEELAVNLAKDKEKRHKPSNTRPNAWYNNCKGQGHF
DMECPSLK
Download sequence
Identical sequences A9STJ7
XP_001769714.1.60028 3218.JGI83800 jgi|Phypa1_1|83800|fgenesh1_pg.scaffold_117000044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]