SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI83823 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI83823
Domain Number - Region: 359-452
Classification Level Classification E-value
Superfamily Acid proteases 0.000579
Family Retroviral protease (retropepsin) 0.04
Further Details:      
 
Domain Number - Region: 48-84
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0262
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI83823
Sequence length 754
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKADMEMEEIIRGMGDLQIKLARLEENTSTNNLKKVSKQGYVQRCIWCD
DASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQINFGKGGMRALVQDYLKELETT
ARESASYGARVDDDLGGRTETSKFWASAVSTMQEGKLPREALLRTAAIIRGRTGWGDPVE
FLSVHAYIAKSQHEALMEEKRRRNFDDTREGNSSKRQTQGDKAREATSQELPVKDTSALL
EEKTRETKDKGKSIAYKLLFDIEVATKLKGVLEERILNAKVEFTLKEVLKIAKKEFRDVI
IDSIKQKRQLMGETGMSHAIDARIYKDKEEVDIGYNDKEMETLSHYTRKHWARATTEVLV
KVGDIEEPIVALVDHGSEINLMSKDLYKKQKWPINMEHGWAIQAANNTRGELYGTCLDVK
IRIGDVATEQHFFVQDTTSYSLILGQPYITATRMKTKVLDDGSAYGRVRSEDGRKAVQFL
TVPPNHERNRDRLREKPLSKIVEGFKDFGDVPLILGVYEENGLRDSLELITSIGLGDNDK
IVEIHSREVYTILESFQAPEVTVETRYKTADKKVKPVAGPLPEDFKEQMEEASKEASLRD
PMSIRHQFIKENFEELKIDSNGSLLLEEITCFKRMLAKQGRSFAFESHEIGYLEYWEQRP
TPLQILSGQVQSPRYSQPGHTEMLRSIPIMGVSKKEKDQFTRRAVLFSVPFQGTLFSVKR
SLKGKNGGESSDDKSQFRIQALTVGANSRSKTED
Download sequence
Identical sequences A9STL9
jgi|Phypa1_1|83823|fgenesh1_pg.scaffold_117000067 3218.JGI83823 XP_001769670.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]