SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI83880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI83880
Domain Number - Region: 304-343
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00759
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI83880
Sequence length 379
Comment (Physcomitrella patens)
Sequence
MENENKNFEGSLGGVCGRGSSKGQDMHMDPSITCMFQAFSLSMQQQQSSDRKEALATKAL
QVVVNKIDQFDGRNISRYLRCYVRKMELNLVFEKKMVELFGLAMISEIKDHITSITDCYG
NSWEVFSHALKDEYFLKDADLVTKKVFLEWIEWPNKNLQATKLLREFERHYSQLSKVEKL
TLEPNKVDLFLQAADGKLQGKLEFLLEDKEEDEGLTTKWKNIEDAVRLLAKRERRKDRSN
IPKTVQASKAPVHTIPPTMPTVQPSKSLSKKVDMEMEEIIRGMQDLQIKLTRLEENNSTN
NLKNISKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFG
KGGMRALVQDYLKEHETAA
Download sequence
Identical sequences A9SU39
jgi|Phypa1_1|83880|fgenesh1_pg.scaffold_118000008 XP_001769812.1.60028 3218.JGI83880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]