SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI83882 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI83882
Domain Number - Region: 370-465
Classification Level Classification E-value
Superfamily Acid proteases 0.00122
Family Retroviral protease (retropepsin) 0.042
Further Details:      
 
Domain Number - Region: 46-84
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0262
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI83882
Sequence length 834
Comment (Physcomitrella patens)
Sequence
MPTIQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCD
DASHTRKDCNEFNNIIRQGIICWKDGKIALKDREDLLQTNFGKRRMRALVQDYLKEHETV
VRESASYGARVDDEIGGSTKTSEFWASAISTMQEGKLPREALLRTAATIRGRTGWEDPVE
SLSLHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQESSLGEKTMET
KDKGKSIAYKLLSDIEAATNLKEVLEERILNAKVEFTLKEVLGIAKKEFHDVIIDSIKRK
RQLMSETGMSHAIDARICRDEEEVDIGYKQPTNEKNGYNQRAHFEDSSDKEMETLSHYTR
KHWARATTEVLVKVGDIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWAIRAANNT
RGELYGPCPDVKIWIGDVATEQHFFVQDTTSYPLILGQPYITATRMETKVLDNGSAYARV
RSEDRRKAVQFLTVPPNHERNRDRLREKPLPKFVKGFKDFGEISLKERKRLYDIEGQLCK
IGTLQDNERILGVYEENGLEDSLELITSIGLGDNDKIVEIHSREVYTMLESFQAPEVTVE
TRYKTADKKVKPVAGPLPEDSKEQMGEASKEASLRDPMSIGHQFTKETFEELKIGSDGSL
LPEEITCFKKMLAKQGRSFAFESHEIGHLEYWEHRPTPVQILSGQVQSLRYSQPGHTEML
RSIPITGVSRKRRTNSHDGFEEPIGSNFDNPIRVLISNMRLELAGLTTGLSQSDVRTNLT
QLREHPGYYGHLPNIGPELVGRLNVVPITGFDSVSGCPVLCAVSGNVVFGKWIS
Download sequence
Identical sequences A9SU41
3218.JGI83882 jgi|Phypa1_1|83882|fgenesh1_pg.scaffold_118000010 XP_001769755.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]