SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI84255 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI84255
Domain Number 1 Region: 330-372
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000759
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI84255
Sequence length 423
Comment (Physcomitrella patens)
Sequence
MIHQHNFDYERRIKQKRDRQLRLAARNVNHIVGEVLQKRRRRQSWIKPWLHACRHIRSYS
VPEREAIFQNYIPLSKLPLSLAGDSSSLIVKSVKRFVKKRIFIKEFGSLFQGALLPNKFK
QLELPAEVLSSPVEEIIKDIERITKSKTITLPILPPIVLLPMASGGVPNVPTGPPVPPIG
PIGPAVPISVPMGQVGDRTTSIAPLPIFSGWPGADPDQHLSQFLTACVANNGQTEDVCNL
ANSITGAMAPATHSTIPIQGVLNPVPLQAVPSPMASTYPQFALYQPPGVNTQELPMLPGS
KETNKTLLLNLTKKMKELVVNMAKEKEKRPKQTNFWCTNCKGQGHMVQDCPSPGNMKIQC
MNCGGKHPTNNCWYLSNPHFNNTMSPPMSWDVNQIQERNRNGWNGSNSKFPRGYQSSSSR
LSN
Download sequence
Identical sequences A9SUT0
XP_001770090.1.60028 3218.JGI84255 jgi|Phypa1_1|84255|fgenesh1_pg.scaffold_121000056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]