SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI84427 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI84427
Domain Number - Region: 288-384
Classification Level Classification E-value
Superfamily Acid proteases 0.00187
Family Retroviral protease (retropepsin) 0.026
Further Details:      
 
Domain Number - Region: 47-72
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI84427
Sequence length 596
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKGDMGIEEIICGMQDLQIKLTRLEKNTSTNNLKNVSKQGYVQRCIWCN
DISHTRKDCNEFINMIQQGVIWWNDGKIALKDIEDLFQINFGKGGMRALVQDYLTEHRIA
SRENISYGARVDDNFDRSIETSEFWASAIFIIQKEKMHRKALLRTTATIRGATGWEDPVE
SLSVHAYIATSLEEKTKETKDKDKSIAYKLLFDIEVATNLKKVLEEHILNAKVEFTLKEI
LGIAKKEFHDVIINNIKRKRQLMVKAGMSHAIDAKLYKDEEETRPTIEVLVKVGDIKGPI
IALVDDGSEINLMSKGLYKKQKWPIDMEHGWTIQATNNTQGKLYGACPDVKIWIEDVVTE
QHFFVQDTTSYLLILGQPYITATQMETKVLDDGSAYARIRSEDRKKVVQFLTVPPNHERN
RDRLREKSLQKLLKDLRILEKYHYKAGLWMYKRGEMKRLYSIKKESRKLGTLEDDEKNLG
VYEESGLEDSLELIAYIGLGDNDKIVEIHSREVYSILESFQAQEVIVETKYKTVDKKVKP
VARLLPKDCKEQMEEASKEESLRDPKKIRHRFTKETFEELKIGCDGSLFPTEIEYF
Download sequence
Identical sequences A9SV79
jgi|Phypa1_1|84427|fgenesh1_pg.scaffold_123000058 3218.JGI84427 XP_001770285.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]