SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI84546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI84546
Domain Number - Region: 402-497
Classification Level Classification E-value
Superfamily Acid proteases 0.000628
Family Retroviral protease (retropepsin) 0.036
Further Details:      
 
Domain Number - Region: 145-168
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0968
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI84546
Sequence length 869
Comment (Physcomitrella patens)
Sequence
MRPELIERLNVVSITGLRFHFRLFCPLCCFGNILSVKVSLKELLLEDKEEDEGLTTKWKN
VEDAVGLLTKRERMKDRRNILKTVQAPKAPVHTTPPTMPTVQPSTSLSKKADMGMEEIIR
GMRDLQIKLARLDENTSRNNLKNISKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIISW
KDGKIALKDREDLLQTNFGKRRMRALVQDYLKEHETAARESASYGARVDDDLGGSTETGT
IQGAKGWKDPIESLSVHAYIAKSQHEALMEEKRRGNFDDTREGNFSKRQTRGDKAWEAAS
QELPIKDISASLEEKTRETKDKGKSIAYKLLSDIEAARNLKGVLEERILNAKMEFTLKEV
LGIAKKEFHDVIIDGIKRKSDKEIETLSHYTRKHWTRATIEVLVKVRDIEEPIVVLVDHG
SEINLMSKDLYKKKKWPIDMEHGWTIRAANNTRGELYGACRDVKIWIEDVAMEQHFFVQD
TTSYPLILGQSYITATRMETKVLDDGSAYAMLRSEDGRKAVQFLTVPPNHERNRDRLREK
PLPKIVEGFKDFGEVLSRDEGAFDASFIGILENGNIMYKKVNDFKRKERKRLYNIKGELC
KLGTLQDDERILGIYEENGLEDSLESITSLGLGDNDKIVEIHSREVYIILESFQTPEVTV
ETRYKTADKKVKPIAGPLPEDSKEQMEEASKEANLRDPMRIGHQFTKETFEELKIGSPGS
LFSKEITCFKKMLAKQGRSFAFESYEIECVDPNIITPMVIFTVPHPIGTNFKTSNPGLTT
GLLANLTRRTNLTQLREHPGLTMGVLPNMRSELVGRLNVVSITGLRFRFKLFRLLCCSGN
ILSVKGSLKGKNGGESFDGGANFGSKMED
Download sequence
Identical sequences A9SVJ1
jgi|Phypa1_1|84546|fgenesh1_pg.scaffold_124000077 3218.JGI84546 XP_001770385.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]