SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI84785 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI84785
Domain Number - Region: 216-246
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0128
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI84785
Sequence length 332
Comment (Physcomitrella patens)
Sequence
MDPSIASLFQAFSLSMQQQQSNDRKEALATKALQAVDFSHALKDEYFLKDADRVTKKLFL
GWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLILQAADGELQEKLEPLLED
KEEDEGLTTKWKNVKDAVRLLTKTERRKDRSNIPKTVQAPKAPVRTIPPTMPTVQPSTSL
SKKADMGMEEIIQEMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCN
EFNNMIRQGIICWKNEKIALKDREDLLQTNFGKGGMRALVQDYLKGHETVARESASYGAR
VDDKIGGSTETSEFWASAVSTMQEGNYLQKHY
Download sequence
Identical sequences A9SW78
3218.JGI84785 jgi|Phypa1_1|84785|fgenesh1_pg.scaffold_127000053 XP_001770585.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]