SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI84874 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI84874
Domain Number 1 Region: 115-149
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000785
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI84874
Sequence length 181
Comment (Physcomitrella patens)
Sequence
MLEECHYDQLLTVEAMMILSLGSQQIQPENVLMDNYPQMAASNVKNVRLQQPINATPLQA
IAPITMTPYFTSPTYQQLELFTNTTVKDPNEASLLNLTKKIEELILNLAKDKEKRHKPSN
TRPNVWYNNCKEQGHFHTECPSPRETDQQIQSQGKMEKINQGPQVLPVHQVEVVQAVLIR
S
Download sequence
Identical sequences A9SWG6
3218.JGI84874 jgi|Phypa1_1|84874|fgenesh1_pg.scaffold_128000058 XP_001770713.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]