SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI85220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI85220
Domain Number 1 Region: 105-140
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000419
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI85220
Sequence length 288
Comment (Physcomitrella patens)
Sequence
MILVQGSYQNPIWNGSMDTYPRMLDTTTNSSANIPMPINVTPLQAIPPNVITVYVPYFSY
QQEVLTATELSIIPAPKDSNEALLLNLMKKMEEMAINMAKDKKKRQKPVNTRNNVWCSNC
KGHGHLVTKCPSPSQMMGQCTFCRGNNRDQQIQNQGKIEEINQGPQASLINEVECIQAVL
IRSEQKGRGSIQHLGDLEAKGQLDPNMRTSNPGLVMGLLLNMRPDLIGLSNEVLIMEASD
LFEAVPFSTQFWKTSCLLKDPLRGRNSKEALSVVPILSPGWKNILPRV
Download sequence
Identical sequences A9SXA1
jgi|Phypa1_1|85220|fgenesh1_pg.scaffold_132000007 XP_001770980.1.60028 3218.JGI85220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]