SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI85224 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI85224
Domain Number - Region: 20-55
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00174
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI85224
Sequence length 313
Comment (Physcomitrella patens)
Sequence
MMKQIQALTEQMAFMVKNQNSNTPPPRIESGNHNLGVWCTTCGQNGHSSLQCRVRPQEEI
EDLSSGKEVIKVVLKDMVEVASLGRSTMSFAGDGMSRVSVGMMANHGRVAIVVAITLPMN
VDNLIRGLKPPNLYYNYEDFRQNHQPPEGLLSRQGYIPVAQNQQGGYRNYANQKQEEVLL
KGPAPPLAKTTVVIEEHEAPSNLVTHELKKDGGGGHENATLDVITRGQAHRQSPIDEEDS
DSSEFEELLDLVALEAAAKEAARIRREVGTAVGDERSSEGSDPGKGLEPGEWEGPDIPEE
EFGGLGRTTPTSY
Download sequence
Identical sequences A9SXA5
3218.JGI85224 jgi|Phypa1_1|85224|fgenesh1_pg.scaffold_132000011 XP_001771026.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]