SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI85225 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI85225
Domain Number - Region: 636-725
Classification Level Classification E-value
Superfamily Acid proteases 0.0103
Family Retroviral protease (retropepsin) 0.048
Further Details:      
 
Domain Number - Region: 319-357
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI85225
Sequence length 1173
Comment (Physcomitrella patens)
Sequence
MFPKTRSQKPTLNQGLERIGRRGGKVVDNKEATPSRNTLINSRSNEEFLKGDIRRNLEKA
LGDVGGNEVLEELEVEELEIEHVVVFYLEYWEHRPTPVQILSGQVQSLRYSQPRHTEMLH
SIPITGVSRKRRTNSQDGFKEPIGSNFDNPIRAVLFSVPSQGTLFSVNGFLKGKNGGESL
TARANFGSKLEVEKLTLEPKKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDA
VRLLTKKERRKDRSNIPKPVQAPKAPVRTTPPTMPTVQPSTSLSKKADMGMEEIIRGMRD
LQIKLARLEENTSINNSKNVSKQGYVQRCIWCNDASHTRKDCNEFNNMIRQGIICWKDGK
IVLKDREDLLQTNFGKGGMRALVQDYLKGHETVTRESASYGARVDDGIGGSTETSEFWAS
AVSTMQEGKLPREALLRTTATIRGTTGWEDPVESLSVHAYIAKSQHEALMEEKRRENFDD
TREGNSFKRQTRGDKAREASSQELPVKDTSTSLGEKTTETKDKGKSIAYKLLSDIEAATN
LKGVLEERILNAKVEFTLKEVLKITKKEFHDVIIDSIKRKRICRDEEEVDIGYKQPTNEK
NGYNQRVCFDDSSDKEMETLSHYTRKHWARATTEVLVKVGDIEEPIVALVDHGSEINLMS
KDLYKKQKWPIDMEHGWTIRAANNTRGELYGACPDVKIRIGDVATEQHFFVQDTTSYPLI
LGQPYIMATRMETKVEEKPLRKIVEGFKDFGEEVLSRDEGAFDASFIGILENGNIMYKKV
EDFKRKERKRLYDIEGQLRKIGTLQDDERILGVYEENGIEDSLELITSIGLGDNDKIVEI
HSREVYTMLESFQPPEVTVETRYKMADKKVKPVAGPLPEDSKEQMGEASKEASLRDPMSI
GHQFTEETFEELKIGSDGSLLPEEITCFKKMLAKQDPEDGVFGDVNLRKIGEQDRTLDFV
PAVEGFVYEMATERLPALDLLVRPRGLPVAMPAGQLVATVPGNLSKFYGTKDEDPTLHME
RYIEILTTSLIGNEGYYLVWFPETLHGEAYNWYWDDDEGHFTTWSQLQVAFLNHFRPEVG
QSTALRALGAVRQQRDEKMANYIRRFDLVCMRYVGGLLNGDTLKQFFIEGFANRSTIKGV
LERNPATLEEVKTAARVVDLIERSYERHWRKED
Download sequence
Identical sequences A9SXA6
jgi|Phypa1_1|85225|fgenesh1_pg.scaffold_132000012 3218.JGI85225 XP_001771027.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]