SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI85334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI85334
Domain Number - Region: 525-620
Classification Level Classification E-value
Superfamily Acid proteases 0.00129
Family Retroviral protease (retropepsin) 0.033
Further Details:      
 
Domain Number - Region: 219-258
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0199
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI85334
Sequence length 680
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVELFGLATIPEIRDHITSITDHYENSWEVFSHALKNEYFLEDADRVTKK
LFLRWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLELL
LEDKEEDEGLTTKWKNVEDAVGLLTKKERKKDRTNISKIVQAPKAPVRTTPPTMPTVQPS
TSLSKKADMGMEEIIRGMRDLQIKLARLKENTSINNSKNVSKQGYVQRCIWCDDASHTRK
DCNEFNNMIRQGIICWKDGKIALKNREDLLQTNFGKGGMRALVQDYLKEHETAARESTSY
GARVDDEIGGSTETSKFWASVVSTMQEGKLPREALLRTAATIRCRTGWEDPVESLSVHAY
IAKRQHKALMEEKRQGNFDDTREGNSSKRQTRGDKAWEAASQELPVKDTSASLGEKTKET
KDKGKSIAYKLLSDIEAATDLKGVEFTLKEVLRIAKKEFHDVIIDSIKRKRQLMGKTGMS
HAIDARIYRDEEEVDIGYKQPTNEKNGYNQRPLYSKHWARATTEVLVKVGDIEEPIVALV
DHGSEINLMSKNLYKKQKWPIDMEHGWAIRAANNTRGELYGASPDVKIRIEDVTMEQHFF
VQDTTSYPLILGQPYITATRMETKVLDDGSAYARVRSEDGRKAVQFLIVPPNHEQNRDRL
REKPLPKIVEGFKDFGEVPL
Download sequence
Identical sequences A9SXK2
jgi|Phypa1_1|85334|fgenesh1_pg.scaffold_133000035 XP_001771111.1.60028 3218.JGI85334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]