SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI85796 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI85796
Domain Number - Region: 385-424
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0118
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI85796
Sequence length 540
Comment (Physcomitrella patens)
Sequence
MLCSIPITGVSRKRRSNSHDGFEEPIGSNFESPILGMLFAVNGSLKGKNGGEGLDDFGLF
GILCNILRPTDWGKKDFDKQSKSIRIDLRYIVAVVYIPAVKTDRLLDYRRISILPSIVRR
PARSPAGNNSKAMIERKLWQLKHCKQWSIKFDRRNISRYLRCYVREMELNRVSEKKMVAL
FGLAMIPEIRDYITSITDRYGNSWEDFSHALKDEYFLEDADPITKKLFLGWIERPNKNLQ
ATELLKEFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKW
KNVEDAVGLLTKKERRKDRSNILKIVQASKAPVRTTPPTMPTVPPSTSLSKKADMDMEEI
IRGMQDLQIKLARLEENTSIINSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGII
CWKDGKIALKNREDLLQTNFGKGRMRALVQDYLKEHETVARESASYGARVDDEIGGSTET
SEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDPVESLSVHAYIAKSQHEALMEEKR
Download sequence
Identical sequences A9SYR7
jgi|Phypa1_1|85796|fgenesh1_pg.scaffold_138000068 3218.JGI85796 XP_001771470.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]