SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86103 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI86103
Domain Number - Region: 206-244
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.023
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86103
Sequence length 782
Comment (Physcomitrella patens)
Sequence
MKPDLVGQHNAVQLQEHPSLTTGLLANMRPELVGQLNVVPIMGLRFRFRLLRPLCRSGNV
LSIKVSLKGFLGEVSGGESSKGQGMHMDPSIASLFQAFSLSMQQQQSNDRKEALATKALQ
AVVNKIDQFDGRNISRRKDRSNIPKTVQAPKAPVCTTPPTMPTVQPSTSLSKKADMGMEE
IIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGI
ICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDNEIGGSTE
ITTIRGRTSWEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTREENSFKRQTRGDKARE
AASQELPVKDTSASLGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTL
KEVLEITKKKFHDVIIDSIKRKRQLMDETGMSHAIDARIYKDEEEVDIGYKQSTNEKNRY
NQQIRFEDYSDKEIETLNHYTRKYSAKATTEVLVKVGDIEEPIVALVDHDSEINLMSKDL
YKKQKWPIDMEHGWAIRAANNTRGELYEACPDVKIRIGDVATEQHFFVQDTTSYPLILGQ
PYITATQMETKVLDDGSAYTRVRSEDGRKVVQFLTVPPNHERNRDRLREKSLPKIVKDLR
ILGRYQDSKEQMGEVSKEASLRDPMNIGHQFTEETFEELKIGSDGSLLPEEITCFKKMLA
KQGRSFAFESHEIGCVDPNIIIPMVIFIVPHETKSHVKGSKIQLTDKNHLKSEKGYSRRK
ID
Download sequence
Identical sequences A9SZM7
jgi|Phypa1_1|86103|fgenesh1_pg.scaffold_142000025 3218.JGI86103 XP_001771798.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]