SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI86122
Domain Number 1 Region: 132-162
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000879
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86122
Sequence length 164
Comment (Physcomitrella patens)
Sequence
MFVKESQPVTVAASLARAKVWEECHYDQLLMVGTTMIPSVGNQVPMTNTTIGSYPRMIAP
SMGNPISQGVVNATPLQAIPPVATYPSTMAYRQPEVPMNATINDSNEALLLNLTKKMEEL
AVHMTKDKEKRHKPSNMRLNVWCNNCKGQGHFDTECPSPHQKMG
Download sequence
Identical sequences A9SZP8
XP_001771811.1.60028 jgi|Phypa1_1|86122|fgenesh1_pg.scaffold_142000044 3218.JGI86122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]