SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86128 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI86128
Domain Number - Region: 355-452
Classification Level Classification E-value
Superfamily Acid proteases 0.000188
Family Retroviral protease (retropepsin) 0.027
Further Details:      
 
Domain Number - Region: 170-209
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0181
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86128
Sequence length 655
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVALFGLATIPKIRDHITSIMDRYGNSWEDFSHALKDEYFLEDVDRITKK
LFLGWIEWPNKNLQATELLREFERHRRTLKMRSDCLQKDWRKDRSNIPKIVQAPKVPVRT
TPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLTRLEENTSIKNSKNVSKQGYVQRC
IWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKNREDLLQTNFGKGGMRALVQDYLKE
HETVARESASYGARVDDEIGGSMETKVLRITKKEFHDVIIDSIKRKRQLMSETGMSHAID
ARICRDEEEVDIGYKQPTNEKNGYNQRVRFEDSSDKEMETLSHYTRKHWARATTEVLVKV
GDIDEPIVALVDHGSEINLMSRELYKKQKWPIDMEHGWAIRAANNTRGLLHGACPDVKIW
IGDVAMEQHFFVQDTTSYPLILGQPYITAIRMETKVLDDGSAYARRDYGGTKEEVLSRDE
GAFDASFIGILENGNIMYKKVDDLKRKERKRLYNIKGQLRKIGALQDDERILDVYEENGL
EDSLELITSIRLGDNDKIVDIHLREVYTMLESFQAPEVILESRYKTADKNMKPVAGPLPE
DSKEQMREASKEASLSDPMSIGHQFNEETFEELKIGSDGSLLPEEITCFKKMLAK
Download sequence
Identical sequences A9SZG1
3218.JGI86128 jgi|Phypa1_1|86128|fgenesh1_pg.scaffold_142000050 XP_001771765.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]