SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86135 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI86135
Domain Number 1 Region: 352-390
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000565
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86135
Sequence length 431
Comment (Physcomitrella patens)
Sequence
MVNKNESIASRKINQLRERQERAQGRNLRREEQERNLKKKHRQNWIKPWLQACRRIRTYQ
EPDRLLILQSYVPLKKLPRALAGNFVNIPVEILRPLTEREGGIEVFGTPLGNFLVGGTAE
TSNRGSADWHELVANKGNYIVFQNPTFLPASQPIKLFAGNNSKARTAESSVIRVRESRDY
FKTNFRGIENSMATRGPAVLIAVQMGTLGDRTTSVAPLPTFRGLPASLERAKVWEECHYD
QHLTVGATMIPSQGSYQMTNWNDTSKSYPGRSDYGTIPQGIVNVVPLQAVLPSLSQPYVA
YSVYQKPIPTKELTNELVSRDPNESLLLTLTKKMDELAVNLVKDTEKRHKPTNMRPNVWC
SNCKGQGHLVTECSSPPQMMVQCTFCGDANKPTGRGQRSCSTGLTSTSRRGGERSAYQGP
TERQESNFGSG
Download sequence
Identical sequences A9SZG8
jgi|Phypa1_1|86135|fgenesh1_pg.scaffold_142000057 3218.JGI86135 XP_001771769.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]