SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86174 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI86174
Domain Number - Region: 203-241
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0144
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86174
Sequence length 501
Comment (Physcomitrella patens)
Sequence
MELNRVFEKKMVALFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADRVTKK
LYLGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPL
LEDKEEDEGLTTKRKDRSNIPKTVQAPKALVRTIPPTMPTVQPSTSLSKKADMGMEEIIR
GMRDLRIKLARLQENTSTNNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQEIICW
KDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDDEIAGSTGTSE
FWASVVSIMQEGKLPREALLRTAATIRGRTGQLRKMGTLQDDERILGVYEENGLEDSLEL
ITSIGLGDNDKIVEIHSREVYTMLESFQAPEVTVETRCKTADKKVKPVAGPLPEDSEEQM
GEASKEASLRDPMSIGHQFTEETFEELKIGSDGSLLPEEITCFKKMLAKEGRSFAFESHE
IGCVDPNIVTPMVIFTVPHVL
Download sequence
Identical sequences A9SZQ3
XP_001771838.1.60028 jgi|Phypa1_1|86174|fgenesh1_pg.scaffold_143000001 3218.JGI86174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]