SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI86414
Domain Number - Region: 46-85
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0207
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86414
Sequence length 650
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNPKNISKQGYVQRCIWCD
DASHTRKDCNKFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETV
VRESASYGARVDDEIGGSMETSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDPVE
SLSVHAYIAKSQHEALMEEKRRGNFDDRVLEERILNAKVEFTLKEVLGIAKKEFHDVIIG
SIKQKRQLMSETGMSHAIDARIYRDEEEVDIGYKQPTNEKNGYNQRVHLKDSSDKEMETL
SHYTRKHWARATTEVLVKVGDIEEPIVALVDHGFEINLMSKDLYKKQKWPIDMEHGWAIR
AANNTWSELYGACPDVKIRIGDVATEQHFFVQDTTSYPEVYTMLESFQAPEVTVETRYKT
ADKKIKPIAGPLPEDSKEQMGEASKEESLRDPMSIGHQFTEETFEELKIGSVGSLLPEEI
TCFKKMLAKQVVYIPVVKTDRLLGYRRISILPSTARRPARSRAGKHVIRHRFGNILSVKS
SLKGKNGGESSDGEPILDPNSQYIQDREYKAVSKINSLGCSGFSVMSRDLAAGAKRIRRA
VEGHPYRFTVYSYSCLYSNSQKPINCLNISESPYYLLQPDAQHVLVQEST
Download sequence
Identical sequences A9T0C7
XP_001772088.1.60028 jgi|Phypa1_1|86414|fgenesh1_pg.scaffold_145000057 3218.JGI86414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]