SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86415 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI86415
Domain Number - Region: 125-189
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0208
Family Insect pheromone/odorant-binding proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86415
Sequence length 223
Comment (Physcomitrella patens)
Sequence
MWSRLRGSILFQAVLFSVPFQGTLFSVNGFLKDKNGGESLTARANFGSKLEDSQWIQDLV
YIPVVKTDRLLGYRWISILPSTARRPARSRAGKHDFWEKFLVGSLLKDKQQQSNDQKEAL
ATKALQAVVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMVALFGLATIPEIRDHITSI
TDHCGNSWEDFSHALKDQYFLEDADRITKKLFLEWIERPNKNL
Download sequence
Identical sequences A9T0C8
3218.JGI86415 jgi|Phypa1_1|86415|fgenesh1_pg.scaffold_145000058 XP_001772089.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]