SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI86461
Domain Number 1 Region: 130-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000654
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86461
Sequence length 251
Comment (Physcomitrella patens)
Sequence
MFVKESQPVTVAASLVRAKVWEECHYDQLLMVGTTMIPSVGNQVPMTNTMIGSYPRIIAP
SIGNPNSQGVVNATPLQAIPPVATYPSPMAYRQPEVPMNATINDSNEALLLNLMKKMEEL
AVHMTKDKEKRHKPSNMRPNVWCNNCKGQGHFDTECPSPHQKMGQYMYCGGKHNTANYWY
LPRQQTMIQPTVWDVNQVQTENMGGWNRNRNNRVNRGFGNFQNPNYNQPYGTNMQNGGQN
QMGNQPSMPIQ
Download sequence
Identical sequences A9T0H3
3218.JGI86461 XP_001772120.1.60028 jgi|Phypa1_1|86461|fgenesh1_pg.scaffold_146000007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]