SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86589 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI86589
Domain Number - Region: 437-531
Classification Level Classification E-value
Superfamily Acid proteases 0.000498
Family Retroviral protease (retropepsin) 0.042
Further Details:      
 
Domain Number - Region: 193-231
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0173
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86589
Sequence length 619
Comment (Physcomitrella patens)
Sequence
MDSSIASMFQAFSLSMQQQQSNDRKKALATKALQAVVNKIDQFDGRNISRYLRCYVREME
LNRVSEKKMVELFGLAMIPEIRDPITSITDRYGNSWEVEKLTLEPNKVDLFLQAVDGELQ
GKLELLLEDKEEDEGLTTKWKNIEDAVGWLTKKERRKDRSNIPKNKHLKLQYVQHQIKLT
RLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDR
EDLLQTNFGKGGMRALVQDYLKEHETAARESASYGARVDDDLGGSTETSWEDRVESLSVY
AYIAKSQHEALMEEKRRGIFDDTREGNSSKRKTRGDKAREATSQELPVNDTSALFGEKTK
ETKDKGKSIAYKLLSNIGAATNLKGVLEECILNAKVEFTLKEVLRIPKKEFHDVIIDSIK
RKSHYTRKHWARATIEVLVKVGDIDEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWE
IRAANNIRGELYGACPDVKIRIGNVAMEQHFFVQDTMSYPLILGQSYITATRMETKVLDD
GSAYARVRSEDERKAVQFLTVLRNHEWNRDRLREKPLPKIVEGFKDFGELGTLQDDERIL
GVYEENGLEDSLELITSIG
Download sequence
Identical sequences A9T0T6
jgi|Phypa1_1|86589|fgenesh1_pg.scaffold_147000082 XP_001772169.1.60028 3218.JGI86589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]