SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86802 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI86802
Domain Number 1 Region: 323-370
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000186
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86802
Sequence length 407
Comment (Physcomitrella patens)
Sequence
MVIKNENLTVKKIRQSRGRIERSQARNLLRNEQKKKLKRNHRQSWIKPWLHACRHIRAYP
EANRHLIFQKYIPLEKLPKALAENLVNRLGFLLRLLTKSGGITEELGTPLDTFPIAETAD
SVKTNSIEWHKLLVNKGQFSVFQNPSFSPPIQPINLFKDNNSKLSRVESLENIFGRDADY
INKRLSVTLSNSMTTGGPAVPIAVQMGTFLTASTTMILVQSNYQYPALNGSVGSYPQMIE
TVVHSSANTQGPVNVTPLQALLPQVTIAYAPYFPYQTQESTLAEKQIIPASKDSNEALLL
NLTKKMEEMAVNMAKDKEKRQKPTNTRTNVWCSNCQGHGHLVTECPSPSQVLGKCTFCGG
KHLTANCWNLQRQQQFSNLTMIPPTPWNVNQVQIGNTFGWHGNRSNR
Download sequence
Identical sequences A9T1G3
jgi|Phypa1_1|86802|fgenesh1_pg.scaffold_150000035 XP_001772430.1.60028 3218.JGI86802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]