SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86875 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI86875
Domain Number 1 Region: 135-178
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000046
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86875
Sequence length 243
Comment (Physcomitrella patens)
Sequence
MFVKESQPVTVAASLARAKVWEECHYDQLLMVGTTMIPSIGNQVPMTNTMIGSYPRMIAP
SMGNPNSQGVVNATPLQAIPPVATYPSPMAYRQPEVPMNATINDSNEALLLNLTKKLEEL
AVHMTKDKEKRHKPSNMRPNVWCNNCKGQGHFDTECPSPHQKMGQCMYCGVKHNTASCWY
LPRQQTMIQPTVWNYWCNIGTCEISGRTNILVELGCDGDASSNNEADFGIGLLTGAGIDF
SNI
Download sequence
Identical sequences A9T1M9
jgi|Phypa1_1|86875|fgenesh1_pg.scaffold_151000024 XP_001772518.1.60028 3218.JGI86875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]